Desember 30, 2010

Saya Perlu Tahu..

Diposting oleh Queenshaquarie di 10.02
Reaksi: 

  1. Bahwa gerak hanyalah ilusi dan waktu hanyalah sebuah konsep.....
  2. Sel2x tubuh manusia menyelesaikan regenerasinya yang baru setiap 72 jam.....
  3. Islandia itu berwarna hijau dan Greenland tertutup dengan es.....
  4. Lempeng bumi bergerak 0,007 Cm setiap harinya......
  5. Rata2x orang di Amerika memiliki 2 kartu kredit dan dijepang rata2x setiap orang memiliki 5 kartu kredit......
  6.  Dalam 4.000 thn terakhir ini hanya Sapi yang tidak mengalami perubahan genetik......
  7. Tulisan Cina untuk "MASALAH" adalah gambar 2 wanita tinggal diatap rumah yang sama.
  8. Tulisan Cina untuk "KRISIS" dan "KESEMPATAN" adalah sama.
  9. Zaier adalah penghasil Cobalt terbesar didunia, 2/3 produksi cobalt dihasilkan di Zaire.
  10. "IBM COMPATIBLE" tidak 100 % compatible kecuali dia dapat menjalankan MIRCOSOFT FLIGHT SIMULATOR.
  11. Semua
    Angsa di Inggris adalah Properti dari Ratu dan mengangu mereka
    merupakan sebuah pelanggaran berat dengan sanksi hukuman penjara.
  12. Leonardo Da Vinci yang menciptakan gunting modern.
  13. Satu2xnya binatang yang telah dijinakan dan tidak disebutkan didalam Alkitab adalah kucing.
  14. Mark
    Twain lahir dihari dimana komet halley melintas dan dia meninggal 76
    thn berikutnya tepat dihari dimana komet halley melintas lagi.
  15. Hard Drive pertama yang diciptakan memiliki kapasitas terbesar adalah 5 MB dan berharga $ 45.000
  16. Pada versi originalnya, Cerita 1001 satu malam dimulai dengan "Alladin seorang bocah cina...."
  17. Menurut survei unesco thn 1996, nama yang paling umum dipakai didunia adalah Mohammed.
  18. Kata2x "Set" adalah kata2x yang memiliki arti paling banyak didalam kamus bahasa inggris keluaran Oxford.
  19. Ikan dari Capt.Jean Luc Picard bernama Livingston dan Kucing dari Lt.Data bernama Spot.
  20. Gas
    Hydrogen adalah unsur yang paling ringan yang ada didunia ini yaitu
    0.08988 g/cc dan hidrogen padat adalah yang terberat didunia ini yaitu
    70.6 g/cc.
  21. Singapore adalah satu2xnya negara dengan 1 stasiun kereta api.
  22. Leeuwarden, sebuah kota dibelanda dapat di lafalkan dengan 255 cara berbeda.
  23. Kata2x yang tertua dan tidak berubah maknanya dalam bahasa inggris adalah "TOWN"
  24. Nama2x benua didunia selalu diawali dan diakhiri oleh hurup yang sama dalam bahasa inggris.
  25. Menurut
    teori relativitas einstein bahwa dimungkinan untuk bergerak lebih
    lambat atau lebih cepat daripada kecepatan cahaya tetapi tidak mungkin
    dapat bergerak sama dengan kecepatan cahaya.
  26. Nama tengah dari Donald Duck adalah Fintleroy.
  27. Bill Gates di Gaji 1 $ setiap bulannya untuk berkerja di Microsoft.
  28. 10 tahun lalu wanita di dunia rata2 ukuran itunya 36B, sekarang sudah 36C
  29. Kembang api, roket, argometer ditemukan oleh org cina yang secara prinsipil sampe skrg ngga berubah
  30. Kebanyakan orang secara tidak sadar lebih sering bebelok kesebelah kanan dibanding kesebelah kiri ketika berjalan.
  31. Lebih banyak orang yang meninggal akibat tersedak dibandingkan mereka yang meninggal karena penyakit jantung koroner.
  32. Kemungkinan orang tersambar petir digurun Nevada lebih besar dibandingkan dengan memenangkan lotto jackpot.
  33. Seekora capung hanya memiliki rata2x waktu hidup 24 jam saja. Dan seekor ikan mas hanya memiliki 3 detik saja ingatan diotaknya.
  34. Pada
    sebuah pertandingan antara Liverpool dan Chester City dithn 68 yang
    berakhir dengan skor 2-2, ke 4 Gol itu diciptakan oleh orang yang sama.
  35. Pertandingan
    dengan penalti terburuk adalah antara Steau bucharest dan barcelona
    pada Piala champion thn 85/86. dari 10 tendangan, 8 berhasil ditahan
    kiper dan 2 berhasil pada putaran ke 3 penalti (Artinya 20 penalti
    sebelumnya tidak ada satupun yang masuk kegawang)
  36. Nama terpanjang di dunia itu datangnya dr Thailand yaitu: "Krungthepmahanakonbowornratanakosinmahintarayudyay
    amahadiloponoparatanarajthaniburiromudomrajniwesma
    hasatarnamornpimarnavatarsatitsakattiyavisanukamph rasit" The
    translation here is pretty much the unabridged history of the city
    rather than a word: krungthep mahanakhon = The land of angels, the
    great city of; amorn rattanakosin = immortality, various of devine
    gems; mahintara yudthaya mahadilok pohp = the great angelic land
    unconquerable; noparat rajathanee bureerom = land of nine noble gems,
    the royal city, the pleasant capital; udomrajniwes mahasatarn = place
    of the grand royal palace; amorn pimarn avaltarnsatit = forever land of
    angels and reincarnated spirits; sakatattiya visanukram prasit =
    predestined and created by the highest devas.
  37. 99% manusia tidak dapat menjilati sikunya sendiri.
  38. 90% orang yang telah membaca kalimat di atas akan mencoba menjilati sikunya sendiri.
  39. Kecoa itu dapat bertahan dari radiasi nuklir
  40. Kucing
    kampung mendengkur setiap 26 kali per detik, sama dengan frekwensi
    mesin disel dalam keadaan idle. Kucing kampung dapat mendengar
    frekswensi suara hingga 65 kHz, sedangkan manusia hingga 20 kHz.
    Kemampuan indera penciumannya 14 kali lebih kuat daripada penciuman
    manusia.
  41. Kucing kampung - atau jenis kucing apapun juga -
    tidak mempunyai 9 nyawa cadangan. Mereka juga tidak selalu mendarat
    dengan ujung kakiknya. Dikatakan bahwa seekor kucing yang jatuh dari
    tingkat 20 mempunyai kemungkinan selamat lebih besar dibanding dengan
    yang jatuh dari tingkat 7, karena seekor kucing membutuhkan ketinggian
    sekurangnya 7 lantai untuk dapat mengatur tubuhnya agar dapat mendarat
    dengan kakinya.
  42. Kucing melangkah dengan kedua kaki kirinya,
    sedangkan pada saat berlari menggunakan kedua kaki kanannya.
    Satu-satunya binatang yang melakukan hal ini adalah jerapah dan onta.
  43. Jantung kita berdenyut rata2 100,000 denyutan/hari
  44. Rata2 manusia mengedipkan mata adalah 6,205,000 setiap tahunnya
  45. Disaat seseorang bersin,dapat mencapai kecepatan 100 m.p.h
  46. Bagian tubuh yg akan selalu tumbuh adalah kuping dan hidung
  47. Gigi adalah satu2nya bagian tubuh yg tidak bisa memperbaiki dengan sendirinya.
  48. Detak jantung anjing antara 70-120 permenit sedangkan manusia hanya sekitar 70-80 permenit.
  49. Kebanyakan
    anjing hanya mampu berlari dengan kecepatan 30,5 km/jam sedangkan
    anjing trah Greyhound dapat berlari dengan kecepatan 64 km/jam. Pantas
    saja kalau trah ini disebut dengan rajanya anjing pelari.
  50. Anjing dengan ukuran terbesar adalah Irish Wolfhound.
  51. Anjing dengan ukuran tubuh terkecil adalah Chihuahua, sementara untuk ukuran berat badan terberat adalah Saint Bernard.
  52. Anjing
    terkecil yang pernah tercatat dalam sejarah adalah seekor Yorkshire
    Terrier yang berasal dari Blackburn (Inggris). Pada saat berumur 2
    tahun hanya memiliki tinggi tubuh 6,35 cm, panjang tubuh 9,5 cm dan
    berat tubuh 113 gram!!!
  53. Anjing yang pernah hidup paling lama
    yang tercatat dalam sejarah adalah seekor anjing Australian cattle-dog
    yang bernama Bluey. Bluey di‰tidurkan‰ pada usia 29 tahun dan 5 bulan
    !!!
  54. Anjing terberat dan terpanjang yang pernah tercatat
    sepanjang sejarah adalah Old English Mastiff yang bernama Zorba. Dia
    memiliki bobot badan 155 kg dan memiliki panjang 3,1 meter diukur dari
    ujung hidung sampai ujung ekor.
  55. Anjing dengan ukuran tertinggi
    yang pernah tercatat dalam sejarah adalah anjing trah Great Dane dengan
    nama Shamgret Danzas. Dia memiliki tinggi 1,06 meter yang diukur dari
    pundak dan memiliki berat tubuh 108 kg.
  56. Anjing trah Dalmatian
    tidak lahir dengan totol-totol hitamnya. Ketika lahir mereka hanya
    memiliki warna putih saja pada bulu mereka. Setelah dua minggu totol
    hitamnya baru akan muncul.
  57. Ada persamaan antara anjing dan
    burung jika memberikan makan pada anak-anakanya yang masih belum bisa
    mencari makan sendiri. Setelah makan kenyang, anjing akan menghampiri
    sarangnya dan akan memuntahkan sebagian isi perutnya untuk dimakan oleh
    anak-anak mereka.
  58. Sendawa pertama yang pernah tersiarkan secara nasional adalah di tahun 1935.
  59. Tikus ML cuma bertahan 5 detik !!!
  60. Dibutuhkan kulit dari 3000 sapi untuk bikin bola football bermerk NFL per tahunnya
  61. Presiden Benjamin Harrison ternyata takut untuk menyentuh saklar
  62. Kalo para cowo Jepang mo bikin sumpah, mereka kencing bareng dan saling menyilangkan air kencingnya yang memancur
  63. Ternyata ada 170,000,000,000,000,000,000,000,000 jalan yang bisa dimainkan pada 10 langkah awal dalam sebuah permainan catur
  64. Ternyata juga, Walt Disney itu takut lho sama tikus
  65. 08. 85% telfon bertemakan cabul dilakukan oleh PRIA
  66. Kuku manusia terbuat dari bahan yang sama dengan bahan pada paruh burung
  67. Piala Oscar yang diberikan pada masa Perang Dunia II ternyata terbuat dari plester/plastik karena saat itu logam sangat langka
  68. Manusia
    tertua yang pernah tercatat (dalam Guinness Book of World Records)
    adalah Jeanne Louise Calment, seorang wanita berkebangsaan Prancis. Ia
    lahir pada tanggal 21 Februari 1875 dan meninggal pada tanggal 4
    Agustus 1997 dalam umur 122 tahun 164 hari
  69. Kemudian, tahukah kamu? Bahwa dia itu seorang perokok dan baru berhenti merokok saat berumur 117 tahun.
  70. Negara Republik Siprus memiliki lagu kebangsaan yang sama dengan lagu kebangsaan Yunani.
  71. Lagu
    kebangsaan yang berjudul "Imnos is tin Eleftherian" itu merupakan lagu
    kebangsaan terpanjang di dunia, yang terdiri atas 158 bait, dan setiap
    bait terdapat 8 baris.
  72. Lagu kebangsaan negara Liechenstein,
    yaitu "Oben am jungen Rhein" mempunyani nada yang sama persis dengan
    lagu kebangsaan Inggris, "God Save the Queen".
  73. Amerika
    Serikat adalah negara yang paling banyak/sering mengganti desain
    bendera nasionalnya. Sejak merdeka Amerika Serikat telah mengganti
    desain benderanya sebanyak 26 kali, terakhir kali dilakukan pada 4 Juli
    1960.
  74. Warna yang paling banyak digunakan dalam
    bendera-bendera negara adalah warna merah, dan simbol yang paling
    banyak dipakai adalah simbol bintang.
  75. Bagian belakang bendera Paraguay mempunyai simbol yang berbeda dengan bagian depannya.
  76. Mata uang tertinggi di dunia adalah Kuwait Dinar (KWD), dengan nilai:1 KWD = 3,40 USD = 31.170,00 IDR
  77. Mata uang terndah di dunia adalah Zimbabwe Dollar (ZWD), dengan nilai:1 USD = 99.200,00 ZWD1 IDR = 10,80 ZWD
  78. Indonesia Rupiah (IDR) adalah mata uang terendah ke-5 di dunia
  79. Kamu nggak pernah bisa mengikat tali sepatu sama kencangnya antara tali sepatu kiri dan tali sepatu kanan
  80. Pulau
    Jawa adalah pulau dengan penduduk terbanyak sekaligus terpadat di
    dunia. Jumlah penduduknya 127.000.000 jiwa dan kepadatan penduduknya
    962 jiwa/km2.
  81. Rotasi Planet Venus sangat lambat sehingga
    periode rotasinya lebih lama dibandingkan periode revolusinya. Tidak
    seperti planet pada umumnya, rotasi Planet Venus bergerak dari arah
    timur ke barat, sehingga JIKA kamu berada di Venus, kamu akan melihat
    matahari terbit di sebelah barat dan terbenam di sebelah timur.
  82. Nama tempat paling panjang di Bumi yang diketahui adalah :Llanfairpwllgwyngyllgogerychwyrndrobwllllantysilio gogogochTerletak di barat laut Wales, United Kingdom. Tetapi kebanyakan orang sering memanggilnya secara mudah sebagai Llanfair PG
  83. Dalam
    keaadan berbaring daya kreativitas lebih tinggi (dibanding duduk) ? dlm
    keadaan duduk terjadi tekanan darah yg lbh tinggi pada bagian kepala,
    leher, punggung. hal ini menyebabkan reseptor tekanan dlm dinding
    pembuluh darah aktiv, yg berakibat daya guna otak menurun &
    ketegangan.
  84. San francisco adl kota dengan homo seksual ter tinggi. 40% lakinya tukang sodok belakang (alias maen anggar)
  85. Sebuah bola baseball memiliki tepat 108 jahitan, sebuah bola untuk sepakbola memiliki 642 jahitan
  86. Dimanakah tempat terpanas di bumi ? Di El Azizia di Libya.Suhunya pernah mencapai 57.8 Celcius pada bulan September 1922.
  87. Dimanakah tempat terdingin di bumi ? Di Vostok, Antartika.Suhunya pernah mencapai -89 Celsius pada bulan Juli 1983.
  88. Lampu
    lalu lintas pertama kali ada di persimpangan London tahun 1868, berisi
    gas yang diselubungi kurungan warna merah dan hijau. Kemudian pada
    tahun 1920 ada yang lebih modern diciptakan oleh Garrett Augustus
    Morgan di Detroit Amerika Serikat untuk signal kereta api yang
    selanjutnya ia patenkan dan kita gunakan hingga kini.
  89. Merokok
    dapat mengurangi massa tulang, terganggunya system hormonal terutama
    Estrogen pada Wanita sehingga menyebabkan Menopause dini .
  90. Ternyata dari hasil penelitian bahwa makan terlalu banyak Protein dan garam dapat mengakibatkan penipisan kalsium pada tulang.
  91. Kopi,
    teh, minuman soda ternyata dapat menyebabkan tubuh kehilangan banyak
    kandungan kalsium di bandingkan dengan orang - orang yang jarang minum
    kopi ,teh atau minuman soda...!?
  92. Ketika baru lahir, kamu hanya
    memiliki 300 tulang. Seiring dengan bertambah besar, beberapa dari
    tulang ini mulai menyatu. Hasilnya? Orang dewasa memiliki hanya 206
    tulang.
  93. Tahukah kamu bahwa manusia dan jerapah memiliki jumlah
    tulang yang sama di lehernya? Sementara leher mereka jauh lebih panjang
    dari kita, yah?
  94. 96 persen mahluk hidup di Bumi tidak memiliki
    tulang belakang. Tapi mereka yang memiliki tulang belakang memiliki
    banyak persamaan: tengkorak yang mengelilingi otak, tulang rusuk untuk
    melindungi jantung dan tulang rahang atau tulang mulut.
  95. Kalsium
    adalah sahabat terbaik tulang. Karena itu, banyak-banyaklah mengonsumsi
    makanan yang mengandung kalsium. Seperti susu. Sehingga tulangmu tetap
    sehat dan kuat
  96. Obat yang dianggap sebagai obat dewa yaitu
    kortison ternyata dapat menyebabkan keropos tulang atau yang dikenal
    dengan Osteoporosis dan memperlambat pertumbuhan tulang.
  97. Tahukah kamu bahwa lidah kita mempunyai kurang lebih 10.000 indra perasa untuk mencicipi masakan yang sedaaap ....!!
  98. Kebiasaan
    minum Alkohol sangat tidak ada faedahnya, karena dapat menjadi
    ketagihan , merusak sel Hati / lever sehingga dapat menyebabkan sirosis
    Hati dan juga osteoporosis dini
  99. Saat ini juga di otak anda sedang terjadi jutaan reaksi kimia yang berbeda.
  100. Deja
    vu bukanlah mengingat kembali kejadian yang pernah terjadi melainkan
    terjadinya kerusakan sementara beberapa sel yang menyebabkan anda
    merasa mengingat kembali suatu yang tak pernah terjadi sebelumnya

di ambil dari http://www.hilman.web.id/index.php?posting=blog&id=285

0 komentar:

 

Queenshaileen Template by Ipietoon Blogger Template | Gift Idea